Foro - Perl en Español

La comunidad de programadores en Perl de habla hispana.
http://perlenespanol.com/foro/

Expresión regular para identificar una línea

http://perlenespanol.com/foro/expresion-regular-para-identificar-una-linea-t5641.html

Página 1 de 1

Expresión regular para identificar una línea

NotaPublicado: 2011-01-04 06:31 @313
por Alfumao
Buenos días,

Estoy dándole vueltas como un loco a una expresión regular que me permita extraer las líneas con esta estructura de un reporte de resultados.

Línea tipo:
Sintáxis: [ Descargar ] [ Ocultar ]
Using text Syntax Highlighting
 2.4e-24  82.8 0.2  4.1e-24  82.1  0.1  1.4  1  STRM_2308 putative Histi
Coloreado en 0.000 segundos, usando GeSHi 1.0.8.4


El problema principal creo que es la expresión regular utilizada para detectar el número "e" (2.4e-24), yo lo he intentado con estas y no ha funcionado:

/^\s+\d+\s+/
/^\s+\d+e\-\d+/
/^\s+\d+\e\-\d+/

¿Alguna sugerencia?

Muchas gracias

Re: Expresión regular para identificar una línea

NotaPublicado: 2011-01-04 07:55 @371
por explorer
Te faltaba por identificar al '.'

/^\s*[\d.e+-]+/

Re: Expresión regular para identificar una línea

NotaPublicado: 2011-01-04 09:30 @438
por Alfumao
Gracias explorer por tu respuesta, pero ahora se presenta un problema, y es que me reconoce también líneas del reporte que no quiero imprimir, te pondré un ejemplo de un reporte tipo para que me puedas entender.

Sintáxis: [ Descargar ] [ Ocultar ]
Using text Syntax Highlighting
Query:       HisKA_3  [M=70]
Accession:   PF07730.3
Description: Histidine kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                  -----------
    2.4e-24   82.8   0.2    4.1e-24   82.1   0.1    1.4  1  NP_722264.1               putative histidine kinase [Strepto
    1.4e-22   77.2   0.3    2.6e-22   76.3   0.2    1.4  1  NP_721890.1               putative histidine kinase [Strepto
    4.3e-22   75.5   3.4      9e-22   74.5   2.4    1.6  1  NP_720926.1               putative histidine kinase [Strepto
  ------ inclusion threshold ------
        2.7    4.8   9.6       0.24    8.2   0.9    3.1  4  24378851 begin_of_the_skype_highlighting              4 24378851      end_of_the_skype_highlighting|ref|NP_720806.1| hypothetical protein SMU.354 [Stre


Domain annotation for each sequence (and alignments):
>> 24380309|ref|NP_722264.1|  putative histidine kinase [Streptococcus mutans UA159]
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   82.1   0.1   8.4e-27   4.1e-24       1      70 []     245     312 ..     245     312 .. 0.99

  Alignments for each domain:
  == domain 1    score: 82.1 bits;  conditional E-value: 8.4e-27
                    HisKA_3   1 ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeirelarealaevRrllgdLRpaal 70
                                ER+RIARE+HD++g++L++i+  ++++  l+  d dp  a+ +l+++ + +re++++vRr l  +Rp+al
  24380309|ref|NP_722264.1| 245 ERKRIAREIHDTLGHALTGISAGIDAVTVLV--DFDPNHAKSQLKNVSDVVREGIQDVRRSLEKMRPGAL 312
                                9******************************..**********************************987 PP

>> 24379935|ref|NP_721890.1|  putative histidine kinase [Streptococcus mutans UA159]
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   76.3   0.2   5.3e-25   2.6e-22       1      66 [.     147     211 ..     147     215 .. 0.97

  Alignments for each domain:
  == domain 1    score: 76.3 bits;  conditional E-value: 5.3e-25
                    HisKA_3   1 ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealdeirelarealaevRrllgdLR 66
                                ER+RI R+LHD++g+++++++l++ela++++  +k    +++++l+e+ +++++++ evR+l+ +L+
  24379935|ref|NP_721890.1| 147 ERNRIGRDLHDTLGHTFAMMSLKTELALKQM--KKGRYeAVQKQLEELNQISHDSMHEVRELVNHLK 211
                                9******************************..999999**************************97 PP

>> 24378971|ref|NP_720926.1|  putative histidine kinase [Streptococcus mutans UA159]
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.5   2.4   1.8e-24     9e-22       1      70 []     132     200 ..     132     200 .. 0.94

  Alignments for each domain:
  == domain 1    score: 74.5 bits;  conditional E-value: 1.8e-24
                    HisKA_3   1 ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeirelarealaevRrllgdLRpaal 70
                                ER+RIAR+LHD+v+Q L+a ++ l+++ ++ld + +  +++++l +i+++++ a++++R ll +LRp++l
  24378971|ref|NP_720926.1| 132 ERKRIARDLHDTVSQELFASSMILSGVSHNLD-QLEKKQLQTQLLAIEDMLNNAQNDLRVLLLHLRPTEL 200
                                9******************************6.44444*****************************987 PP

>> 24378851|ref|NP_720806.1|  hypothetical protein SMU.354 [Streptococcus mutans UA159]
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   0.9   0.00048      0.24      23      64 ..      48      84 ..      45      85 .. 0.81
   2 ?    1.4   0.1     0.061        30      30      59 ..      85     112 ..      82     114 .. 0.86
   3 ?   -2.6   0.1      0.98   4.8e+02      55      62 ..     119     126 ..     116     131 .. 0.67
   4 ?   -2.2   0.0      0.79   3.9e+02      49      63 ..     150     164 ..     143     166 .. 0.67

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.00048
                    HisKA_3 23 qlelarrlldsdkdpeearealdeirelarealaevRrllgd 64
                               qle+a      + +  ++ ++l++++  +++ l+++R++l++
  24378851|ref|NP_720806.1| 48 QLEVAN-----KNQLLAINQQLTRLQNDLSQQLTDLREVLHQ 84
                               666665.....44444889*********************95 PP

  == domain 2    score: 1.4 bits;  conditional E-value: 0.061
                    HisKA_3  30 lldsdkdpeearealdeirelarealaevR 59
                                +l   +  ++++++l++i   ++++ +e+
  24378851|ref|NP_720806.1|  85 NL--NDSRDRSDKRLEQINLQLNQSVKEMQ 112
                                66..778889*****************995 PP

  == domain 3    score: -2.6 bits;  conditional E-value: 0.98
                    HisKA_3  55 laevRrll 62
                                l+e+R+++
  24378851|ref|NP_720806.1| 119 LEEMRQTV 126
                                45666665 PP

  == domain 4    score: -2.2 bits;  conditional E-value: 0.79
                    HisKA_3  49 elarealaevRrllg 63
                                e ++++l e+ ++++
  24378851|ref|NP_720806.1| 150 ENVNQGLGEMKNMAR 164
                                456677777766665 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (70 nodes)
Target sequences:                       1960  (579731 residues)
Passed MSV filter:                        66  (0.0336735); expected 39.2 (0.02)
Passed bias filter:                       66  (0.0336735); expected 39.2 (0.02)
Passed Vit filter:                        16  (0.00816327); expected 2.0 (0.001)
Passed Fwd filter:                         5  (0.00255102); expected 0.0 (1e-05)
Initial search space (Z):               1960  [actual number of targets]
Domain search space  (domZ):               4  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.04
# Mc/sec: 1014.53
//
Coloreado en 0.001 segundos, usando GeSHi 1.0.8.4



Las que yo quiero extraer son las que están en la sección Scores for complete sequences.

Re: Expresión regular para identificar una línea

NotaPublicado: 2011-01-04 10:28 @477
por explorer
Si, suponemos, que la parte que nos interesa, está entre las líneas Scores for complete sequences e inclusion threshold, podemos usarlas como referencias para acotar la zona que queremos analizar:
Sintáxis: [ Descargar ] [ Ocultar ]
Using perl Syntax Highlighting
  1. #!/usr/bin/perl
  2. use strict;
  3. use warnings;
  4. use diagnostics;
  5.  
  6. use autodie;
  7.  
  8. open my $fh, '<kk.txt';
  9.  
  10. while (<$fh>) {
  11.     if (/^Scores for complete sequences/ .. /inclusion threshold/) {
  12.         print if /^\s*\d[\d.e+-]*/;
  13.     }
  14. }
  15.  
  16. close $fh;
  17.  
  18. __END__
  19.     2.4e-24   82.8   0.2    4.1e-24   82.1   0.1    1.4  1  NP_722264.1 putative histidine kinase [Strepto
  20.     1.4e-22   77.2   0.3    2.6e-22   76.3   0.2    1.4  1  NP_721890.1 putative histidine kinase [Strepto
  21.     4.3e-22   75.5   3.4      9e-22   74.5   2.4    1.6  1  NP_720926.1 putative histidine kinase [Strepto
  22.  
Coloreado en 0.003 segundos, usando GeSHi 1.0.8.4

Hay un cambio en la expresión regular: hay un \d más, al principio. Si no lo hiciéramos, nos sacaría las líneas que comienzan por guiones. Poniendo el \d delante, obligamos a que la línea comience con un dígito.

Re: Expresión regular para identificar una línea

NotaPublicado: 2011-01-11 14:47 @657
por Alfumao
Muchas gracias Explorer, pero hay un problema. Yo necesito que al leer el reporte, me reconozca cada línea individualmente para luego realizar un separación de sus elementos (vía split). Así una vez dividida la línea en partes y asignadas cada una de estas a diferentes variables, puedo hacer el "parsing" de dicha línea e imprimir una archivo de salida con los datos que me interesen exclusivamente (no sé si me explico).

Es decir que si selecciono de golpe todo el bloque de resultados como propones, no puedo extraer los datos que me interesan de la forma que expliqué, por eso necesito que la expresión regular me reconozca ese tipo de líneas y de forma individual...

Muchas gracias por tu atención, como siempre. :wink:

Re: Expresión regular para identificar una línea

NotaPublicado: 2011-01-11 14:58 @665
por explorer
Yo no estoy imprimiendo un bloque.

Si te fijas, en la línea 12 solo estoy imprimiendo una línea cada vez. Ahí está la expresión regular de las líneas interesantes.

Solo tienes que modificar esa línea para procesar cada línea, con el split().

Sintáxis: [ Descargar ] [ Ocultar ]
Using perl Syntax Highlighting
  1. if (/^\s*\d[\d.e+-]*/) {
  2.     # ... procesamos la línea
  3. }
Coloreado en 0.001 segundos, usando GeSHi 1.0.8.4

Re: Expresión regular para identificar una línea

NotaPublicado: 2011-01-11 15:17 @678
por Alfumao
Tienes toda la razón, yo sustituí mal en mi programa y seleccionaba todo como un bloque, lo voy a modificar y te comento.

Gracias de nuevo.
Todos los horarios son UTC - 6 horas [ DST ]
Página 1 de 1
Powered by phpBB® Forum Software © phpBB Group
https://www.phpbb.com/