Query: HisKA_3 [M=70]
Accession: PF07730.3
Description: Histidine kinase
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-24 82.8 0.2 4.1e-24 82.1 0.1 1.4 1 NP_722264.1 putative histidine kinase [Strepto
1.4e-22 77.2 0.3 2.6e-22 76.3 0.2 1.4 1 NP_721890.1 putative histidine kinase [Strepto
4.3e-22 75.5 3.4 9e-22 74.5 2.4 1.6 1 NP_720926.1 putative histidine kinase [Strepto
------ inclusion threshold ------
2.7 4.8 9.6 0.24 8.2 0.9 3.1 4 24378851 begin_of_the_skype_highlighting 4 24378851 end_of_the_skype_highlighting|ref|NP_720806.1| hypothetical protein SMU.354 [Stre
Domain annotation for each sequence (and alignments):
>> 24380309|ref|NP_722264.1| putative histidine kinase [Streptococcus mutans UA159]
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 82.1 0.1 8.4e-27 4.1e-24 1 70 [] 245 312 .. 245 312 .. 0.99
Alignments for each domain:
== domain 1 score: 82.1 bits; conditional E-value: 8.4e-27
HisKA_3 1 ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeirelarealaevRrllgdLRpaal 70
ER+RIARE+HD++g++L++i+ ++++ l+ d dp a+ +l+++ + +re++++vRr l +Rp+al
24380309|ref|NP_722264.1| 245 ERKRIAREIHDTLGHALTGISAGIDAVTVLV--DFDPNHAKSQLKNVSDVVREGIQDVRRSLEKMRPGAL 312
9******************************..**********************************987 PP
>> 24379935|ref|NP_721890.1| putative histidine kinase [Streptococcus mutans UA159]
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 76.3 0.2 5.3e-25 2.6e-22 1 66 [. 147 211 .. 147 215 .. 0.97
Alignments for each domain:
== domain 1 score: 76.3 bits; conditional E-value: 5.3e-25
HisKA_3 1 ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealdeirelarealaevRrllgdLR 66
ER+RI R+LHD++g+++++++l++ela++++ +k +++++l+e+ +++++++ evR+l+ +L+
24379935|ref|NP_721890.1| 147 ERNRIGRDLHDTLGHTFAMMSLKTELALKQM--KKGRYeAVQKQLEELNQISHDSMHEVRELVNHLK 211
9******************************..999999**************************97 PP
>> 24378971|ref|NP_720926.1| putative histidine kinase [Streptococcus mutans UA159]
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 74.5 2.4 1.8e-24 9e-22 1 70 [] 132 200 .. 132 200 .. 0.94
Alignments for each domain:
== domain 1 score: 74.5 bits; conditional E-value: 1.8e-24
HisKA_3 1 ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeirelarealaevRrllgdLRpaal 70
ER+RIAR+LHD+v+Q L+a ++ l+++ ++ld + + +++++l +i+++++ a++++R ll +LRp++l
24378971|ref|NP_720926.1| 132 ERKRIARDLHDTVSQELFASSMILSGVSHNLD-QLEKKQLQTQLLAIEDMLNNAQNDLRVLLLHLRPTEL 200
9******************************6.44444*****************************987 PP
>> 24378851|ref|NP_720806.1| hypothetical protein SMU.354 [Streptococcus mutans UA159]
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 8.2 0.9 0.00048 0.24 23 64 .. 48 84 .. 45 85 .. 0.81
2 ? 1.4 0.1 0.061 30 30 59 .. 85 112 .. 82 114 .. 0.86
3 ? -2.6 0.1 0.98 4.8e+02 55 62 .. 119 126 .. 116 131 .. 0.67
4 ? -2.2 0.0 0.79 3.9e+02 49 63 .. 150 164 .. 143 166 .. 0.67
Alignments for each domain:
== domain 1 score: 8.2 bits; conditional E-value: 0.00048
HisKA_3 23 qlelarrlldsdkdpeearealdeirelarealaevRrllgd 64
qle+a + + ++ ++l++++ +++ l+++R++l++
24378851|ref|NP_720806.1| 48 QLEVAN-----KNQLLAINQQLTRLQNDLSQQLTDLREVLHQ 84
666665.....44444889*********************95 PP
== domain 2 score: 1.4 bits; conditional E-value: 0.061
HisKA_3 30 lldsdkdpeearealdeirelarealaevR 59
+l + ++++++l++i ++++ +e+
24378851|ref|NP_720806.1| 85 NL--NDSRDRSDKRLEQINLQLNQSVKEMQ 112
66..778889*****************995 PP
== domain 3 score: -2.6 bits; conditional E-value: 0.98
HisKA_3 55 laevRrll 62
l+e+R+++
24378851|ref|NP_720806.1| 119 LEEMRQTV 126
45666665 PP
== domain 4 score: -2.2 bits; conditional E-value: 0.79
HisKA_3 49 elarealaevRrllg 63
e ++++l e+ ++++
24378851|ref|NP_720806.1| 150 ENVNQGLGEMKNMAR 164
456677777766665 PP
Internal pipeline statistics summary:
-------------------------------------
Query model(s): 1 (70 nodes)
Target sequences: 1960 (579731 residues)
Passed MSV filter: 66 (0.0336735); expected 39.2 (0.02)
Passed bias filter: 66 (0.0336735); expected 39.2 (0.02)
Passed Vit filter: 16 (0.00816327); expected 2.0 (0.001)
Passed Fwd filter: 5 (0.00255102); expected 0.0 (1e-05)
Initial search space (Z): 1960 [actual number of targets]
Domain search space (domZ): 4 [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.04
# Mc/sec: 1014.53
//
Coloreado en 0.003 segundos, usando
GeSHi 1.0.8.4